dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

2035946184 (Fungus garden combined (combined))

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment AECFG_455910 Glutathione S-transferase [Fungus garden combined (combined)]
Sequence length 209
Sequence
MSNPIKLYNFPKSGHAHRIELMLSLLNLPTELVFVDLAKGAHKQPDFLALNPFGQVPVID
DNGTVIADSNAILVYLAKKYDNGTWLPEEPAAAARVQRWLSVAAGPLAFGPAAARLVTVF
GASFNTDEVITRAHTLLKVIDAELAKTPFLAGSTPTIADIANYSYIAHAPEGNVSLEPYA
NVRSWLARIEALPRFVPMPRTVIGLQTSA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]