dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

2001470622 (Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Enzyme involved in the deoxyxylulose pathway of isoprenoid biosynthesis [Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2]
Sequence length 87
Sequence
MNELETRLEDITVPMDVAVIGCIVNGPGEAKEVDIGLTGGTPNNLIYIDGEPSQKLSQDN
LVDELEHLIRSKASKKAEQEENIIAKS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]