dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ITC1587_Bchr10_P30636 (Musa balbisiana)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ap2 erf and b3 domain-containing transcription repressor tem1-like
Sequence length 323
Sequence
MEGRCVEEASSDWVKRLHVSKVLQRMGSGVSVVLDPSAEGGGIEAESRKLPSSRYKGVVP
QLNGRYGAQIYERHQRVWLGNFGDEAEAARAYDVAAQRFRRCDAVTNFKPLTESNDEEAA
ELSFLVAHSKAEIVDMLRKHTYHDELQQSKQALHSAREILFDKVVTPSDVGKLNRLVIPK
QHAEKHFPLKNGSSVARNGVLLNVEDASGKMWRFRYSYWNSSRSYVLTKGWSRFVKEKSL
KAGDMVSFWRSTGPEKQLCIDWKTSPVACNRAVPPAIRPLPVVKLFGVDISGVPASGGDG
KRGREMELFPPPQFFKKQFVEAL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]