dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ITC1587_Bchr11_P33945 (Musa balbisiana)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment transcription factor bhlh70-like
Sequence length 1029
Sequence
MEFTRGRDMSRMTEQQDAWKHASFVPSSTSSSSSPSLPPSSFAPFRWNDGSSGSSGRGEE
SCVEKEHMFDKVVTPSDVGKLNRLVIPKQHAEKYFPLDAGDNGKGLLLSFEDRNGESWRF
RYSYWSSSQSYVMTKGWSRFVKEKRLHAGDTVSFGRGLGDSGRDQLYIDWKRRPGNHDAA
RMPQIYFPGVSFARSVGRLGTHLFMPPPPPPPPPPTAYDQHLQGYGCNVMSPGALGGQLI
FFQSPLTAPPPVEMHSGGLSMVLDPAPVVHNQATAKNVRLFGVNLVCAGSEDSSKAVNST
FLKVEDGRTGLVQQSVENTEASGNGDEHGNKLFHHQLELSKRVGEGAHRDVCPGFMLGHT
ADDENVRLILQEQSAGFGVSTGHGKAFLGDNMLTWNQFNNRKKNEYADPDEEIRLRENRK
KDSKEDDAPVIEDVKDDDGDDEDGDDDDGDAEDSSDVFLSFFVEYAVGDHKAGADNSSKQ
SRSEKKSRKAMMKLGMKPVTGASRITIKRTKTPDVFKNPNSDTYVIFGEAKIEDLSSQLL
NNSEFQTSATWWPRLFGIIDPLLFPPFTSCICLRHIKVDQYPLLCLMQPNVPQTMWLSPH
YPLVNCCIPDLSPAFILHPKVQTCEMGRRGRTRVLNDFDTSSASIYCSWQVESAGDGLSS
KCVEPGTATASFSDHLKMSCGSLSSHQTPVLRLLQGAMQAGEEMVEEEVQLHLQQYQHRR
FFTSYPQETNFQLLRRMQSQCHFRQLRMAEMDRSCAVEQLESCVTHVSESETRGIVHRED
PATAAATGPMRSLAAAGSNERRNRKRQRPASASKSAEEAESQRMTHIAVERNRRHLMNVH
LATLRALMPPSFVQRGDQASIIGGAIEFVKELEQHLLSLRAQKRFRESAFARSSSDDDDP
CRATLPLLHDDFLISPQYTGYSQSQRRRRDGNGEEPHQEDWTGVDVEATLVQGHVNLKVA
GRRQRGQLVRAIAAMEELRLSILHLNITSLGPSSILYSLNLKMEEECKLGTADEIATAVH
QIFSYNSNC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]