dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ITC1587_Bchr1_P01310 (Musa balbisiana)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment skp1-like protein
Sequence length 257
Sequence
MEKKITLRSSDGEVFEVDVAVAMESQTIKHMIEDDCAENGIPLPNVNAKILAKVIEYCRK
HVDAAASKSSDDASKVADEELKAWDAEFVKVDQATLFDLILHQVKKHNKVDDKLGEGLPG
IGLFAFTRIEWWILTFGGVDVVIISEPEDVTGPPYFMNALMGPTGYKNLFVYDGVKGTEA
RPVKDIRTKGGSTGLDVFNHAANYLNIKGLLDLTCQTVADMIKGKTPEEIRKTFNIKNDF
TPEEEEEVRRENQWAFE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]