dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ITC1587_Bchr2_P04515 (Musa balbisiana)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment sulfate transporter
Sequence length 684
Sequence
METHSSSASGGGVARVASSSSLGGGGGRAVKVIPLQNPAPPSPYLQSAALASRWAAKVRG
MSALAWLELLLPCSRWIRTYRWREYLQADLMAGITVGVMLVPQAMSYAKLAGLQPIYGLY
GGFVPVLVYAVFGSSRQLAVGPVALTSLLVSNVLSPIVDSSDELYTELAILLALMVGILE
CLMGLFRLGWIIRFVSHSVISGFTTASAIVIALSQSKYFLGYSIVRSSKIIPLVKSIIAG
ADDFSWPPFVMGSIFLTVLLTMKHLGKSNKNLRGVRAAGPLTAVVLGTIFVKIFHPSSIS
VVGEIPQGLPKFSIPRGFEHVKSLISTAFLITGVAILESVGIAKALAAKNGYELDSNQEL
FGLGVANICGSFFSSYPSTGSFSRSAVNNESGARTGLSGIIMGIIMACALLFLTPLFTEI
PQCALAAIVISAVMGLVDYEEAIFLWCLDKKDFLLWTITFITTLFFGIEIGVLIGVGVSL
AFVIHESANPHIAVLGRLPGTTVYRNILQYPEAYTYNGIVIIRIDSPIYFANISYIKDRL
REYELDLDGSTKRGPDVGRIYFVIIEMSPVTYIDSSAVQALKDLNQEYRSRGIQIAIANP
NREVHLLLSRSSLIEMIGKEYFFVRVHDALQVCLQHVQSLNPSSPKVSSGHTPPRTLSFL
QSIWKQGSDGSTPEAEPLLPRNEV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]