dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ITC1587_Bchr5_P12569 (Musa balbisiana)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment y2835_orysj ame: full=b3 domain-containing protein os02g0683500
Sequence length 339
Sequence
MEFSIRRDGFYMTEEEKQEENSKYLSFVPLSSSFSSPSTSNAFRWHVGPSDSAGRSASDG
YNESNFFTGKEHMFDKVVTPSDVGKLNRLVIPKQYAEKYFPLHQTANEKGMLLSFEDRLG
KSWRFRYSYWNSSQSYVMTKGWSRFVKEKRLDAGDIVSFGRGVGDSGGDHLYIDWKRRPD
NHDLPRLPRIPLAGVSLARPSGPWSGSPFLIPPPAVFDHRRPGFNNNAMNSGTTSGDQFL
FFGSSLAGPPQFGVQQGSGPPMAVVNSLPLLGNQAAAKRVRLFGVNLDCPESGGLSASAS
QLQSSSSLPFLPFPHESIGSSAAPSSTSKEQHLSLDLDL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]