dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ITC1587_Bchr5_P13242 (Musa balbisiana)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment regulatory protein npr5-like
Sequence length 505
Sequence
MEESLKSLSLDYLNLLINGQAFSDVTFSVEGRLVHAHRCVLAARSLFFRKFFCGAEPSSP
SGLLLLNPHDRHSPRSPTGGASMSSSSSPRGSACTAGSVIPVNYVSYEVFLLMLQFMYSG
QVPLVPQKHEPRPSCSDRGCWHTHCTAAVDLALDTLAAARSFGIEQLALLTQKQLASMVE
KATIEDVMKVLIASRKQDMNQLWNTCSHLVAKSGLPPEVLAKHLPIDVVAKIEELRLKSS
LTGRSFITHHHSLEAAGASTELEDHHKIRRMRRALDSSDVELVKLMVMGEGLNLDDALAL
HYAVENCTREVVKALLELGATDVNFRAGPAGKTPLHIAAKMVCPDMVAVLLDHHADPNIR
TFDGVTPLDILRNLTSDFLFKGAVPGLTHIEPNKLRLCLELVQSAALVMSREDAKSGGGG
NHPHSAIYPPMNQQESNTCNANHTSSSMVNLSLDSRMVYLNLGMAERLGCKMSDGADDSS
SSRSLGGGGVGNIGLSSMFSSHGFP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]