dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ITC1587_Bchr6_P15079 (Musa balbisiana)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment sulfate transporter
Sequence length 864
Sequence
MAHSVSDEVESKDIEMANRSSSHRQTENHKSVHKVGLPPRRNFIGEFSEMLKETFFADDP
LRPYKDQPRSRQLVLGLRFLFPIFEWGRSYNLSKFKGDVIAGLTIASLCIPQDIGYAKLA
NMDAKNGLYSSFVPPLIYAVMGSSRDIAIGPVAVVSLLLGTLLQNEVDPENNKEDYLRLA
FTATFFAGVTQAALGFLRLGFLIEFLSHAAIVGFMGGAAITIALQQLKGFLGIKKFTKNT
DIISVMKSVWGSVHHGWNWQTILIGTMFLAFLLSAKYIGKKNRKFFWVPAIAPLISVILS
TFFVYITRADKHGVQIVKKIDRGLNPSSVSQIHFSGPYAAKGFRIGVVAGMIALTEAIAI
GRTFASMKEYQLDGNKEMVAIGTMNIVGSMSSCYVATGSFSRSAVNFMAGCQTSVSNIVM
SMVVMLTLLVITPLFKYTPNAILSSIIISAVISLIDYEAAFLIWKVDKLDFIACMGAFFG
VVFVDVEIGLLIAVSISLAKVLLQVTRPRTALLGHLPSTMVYRNIEQYPEATKVPGVLIV
RVDSAIYFTNSSYVKERILRWLREEEEQLRAKNLPQINFLIVEMSPVTDIDTSGIHAFEE
LYRSLQKHEIQLVLANPGSVVIQKLHLAKFTELIGHDKIFLSVGEAVMTFFICKLALCGT
KQKWDCKSQRAMSRSYERLHLKCELTNIKLTKLNSPDFVGNLFIRCYVNAGGGRRIMIDS
CDVPPTGDPTWDRMASVECSGSSRHVRDLLERHGIVFELRGRRSDRRQAAEAATCSELLG
TAEVPWRDICGPTDTSVHRHVGLVMAGSAHVGDTPPEAVVYMAVRVSKVGKVSKTMEWED
GCEWSVGEEDVFAAAAAAVVDDAF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]