dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ITC1587_Bchr8_P23466 (Musa balbisiana)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment b3 domain-containing transcription factor fus3-like
Sequence length 262
Sequence
MAGINKQQEAPSTVRDGGGRWSPSSTAESPVVALQQPTPMLHLEKCSHFHVHAEQGINVG
LRAGLESASPCSWCKVHLKIMSIYYFLQRFEILAHLSFSKLWKEAEAHLPCLTSREGIVI
NMDDLDNLQAWTFKYRFWPNNRSRMYVLENTGDYVKKNCLQLGDFILIYKDDSKDRYVIR
AKKTGSAELCVAPADEGIFDSIVPDIVVGSARYSDLFLPLADGINIAYGYGLSCAFDQDF
PMTFLDESTGSASIASHKSSDH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]