dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ITC1587_Bchr9_P27446 (Musa balbisiana)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ap2 domain-containing transcription factor
Sequence length 313
Sequence
METSSIGDAWGESRKRDESRKLPSSRYKGVVPQPNGRWGAQIYEKHQRVWLGTFNAEAEA
ARAYDVAVRRFRGRDGVTNFKPLNEADDDDAAELSFIGSRSKVEIVDMLRRHSYPHELQQ
SRRSIGADKMKTVPSRGAAVAGATESPVGAKRQHLFDKALTLSDVGKLNRLVIPKQHAEK
HLPLQEAGGGASNGMLLNFEDACGRVWRFRYSYWNSSQSYVLTKGWSRFVKEKGLAAGDV
VSFQRSTGPEKQLFIDSKARAGRGHTAVPMPRPAVQHFRLFGVNIIRNPATHRYDMELIS
SQDMFKRQRTEAL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]