dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|336234407|ref|YP_004587023.1| (Geobacillus thermoglucosidasius C56-YS93)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MutS2 protein [Geobacillus thermoglucosidasius C56-YS93]
Sequence length 784
Sequence
MHTRVLHILEFDKVKEQLLEHVSSSLGKEKVEKLLPSSRLAEVVNWQEETDEAAAALRLR
GHVPLGGIVDIRASLKRVKIGGTLSPHELLDISSTISASRQLKQFIESLHEEKEEFPHLA
GYAEKLVALPEVQQAIERCIDDHGEVLDHASERLRSIRQQLRTTEARVREKLESIIRSPS
AQKMLSDAIITIRNDRYVIPVKQEYRGAYGGIVHDQSASGATLFIEPQAVVELNNQLQEA
RVKEKREIERILTELTGIVAGHAEALLENVGILAQLDFIFAKAKYANKLKATKPALNDRG
YIRLLQARHPLIDQEAVVPNDIELGKEYTTIVITGPNTGGKTVTLKTIGLLTLMAQAGLF
IPALDGSELAVFRSIYADIGDEQSIEQSLSTFSSHMVNIVEILRDVDHESLVLFDELGAG
TDPQEGAALAIAILDEVHGRGARTVATTHYPELKAYGYNRDGVINASVEFDTETLRPTYK
LLIGIPGRSNAFEISKRLGLAERIIERAKLHISAESNNVENMIASLEQSKKRAEEELKKA
EEARMEAEQLRRDWEQKWEELHEKREEIIEEAKRKAADIVRSSQQKAERIIHELRRMQQE
KQAEIKEHELIEAKKRLQEAMPTLEKKKKERKKQATHSFQPGDEVKVISLNQKGYLVEKV
SDDEWQVQLGILKMKINERDLEYIGSAPKTETKPLATVKGKDYHVGLELDLRGERYEDAL
ARLEKYIDDALLAGYPRVSIIHGKGTGALRKGVQEFLKTHRAVKSFHFGGANEGGTGVTI
VELK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]