dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|409912753|ref|YP_006891218.1| (Geobacter sulfurreducens KN400)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment proton/sulfate symporter family protein [Geobacter sulfurreducens KN400]
Sequence length 590
Sequence
MRLTPSSLLPEWLRSYRPADLLPDLAAGAVVAVILAPQGMAYALLAGLPPIMGLYAATVP
LLAYALAGSSRHLSVGPVAIVSLLVHVACSKVAHAGSASYVSAALQLALLTGVLQLLLGT
VRAGFMVNFLSRAAIGGFTSAAALLISLSQFKNLLGISGDGGESALELAAGVVRNIGTLH
LLTSVMGLAAICMLLLLQRFAPRFPAPLAAIVLGIPLTALLHLDQAGVRTVGDLPHGLPP
LSLPPFAADQILTLLPAAVTIALIGYLESFAVAGLIADREKYPIYPNRELVGLGIANVAA
AFFSGYPVTGGFSRTAVNHRAGARTGLAGMITATLIGIILLHFTHLFHYLPKTILAAIVI
VAVAGLVEAAEARYLFRVKPSDGYTFVLTFLVTLGFGVEAGIVAGVIFSLLVFIWRSAHP
HIAELGWLEEEGVFRNIRRYPHAVVPRGMLLVRVDASLYFANMAFVGDWLRATLAERADV
RQIIFDLSGVNDMDAVALAALEVIIEGHGERGIVVAFAGMKGPVRDLAQRAGWQERYGNL
ISFLSLNQAVRQMSTEDMILAGLHSKERESETCSVPATRPTGSTNHGDPA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]