dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

OBART02G03410.1 (Oryza barthii 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel chromosome:ABRL00000000:2:2129872:2136488:-1 gene:OBART02G03410 transcript:OBART02G03410.1 description:""
Sequence length 1159
Sequence
MASMKQQQTPASSAVTAAAAASSSATAAVAACEGERKAAAINSELWHACAGPLVSLPPVG
SLVVYFPQGHSEQVIIISLSLSLSSSSIIDLVAASMQKDVDAHVPSYPNLPSKLICLLHG
VNLHADPDTDEVYAQMTLQPVNTYGKEALQLSELALKQARPQMEFFCKTLTASDTSTHGG
FSVPRRAAEKIFPPLDFSMQPPAQELQARDIHDNVWTFRHIYRGQPKRHLLTTGWSLFVS
GKRLFAGDSVIVVRDEKHQLLLGIRRANRQPTNISSSVLSSDSMHIGVLAAAAHAAANSS
PFTIFYNPRASPTEFVIPFAKYQKALYSNQISLGMRFRMMFETEELGTRRYMGTITGISD
LDPVRWKNSQWRNLQVGWDESAAGERRNRVSIWEIEPVAAPFFLCPQPFFGVKRPRQLDD
ESDMENLFKRAMPWLGEEVCIKDTQNQNSTAPGLSLVQWMNMNRQQSSSLANTAAQSEYL
QALGNPAMQNLAADELARQLYVQNNLLQQNCIQFNSPKLPQQMQTMNDLSKAAIPLNQLG
AIINPQDQKQDAVNHQRQQNSIQVIPLSQAQSNLVQAQVIVQNQMQQQKPSPTQNPQRIN
GQRLLLSHQQQDQNLQLQQQLLLQQKQQLQQQQQQQQNQQQLNKSLGQLVNLASQQSKLF
DEELQLQILQKLQQQSLMSQSTSTLSQPPLIQEQQKLITDMQKQLSNSHSLAQQQMMPQQ
EIKPSLQATPLLPTVQQEQQQKLLQKQVSLADVSGVAFQPISSTNVIPKTGGAMIISGAT
QSVVTEEMPSCSTSPSTANGNHFTQSTKNRHCINTERLPPSTAPMLIPTSIDAVTATPLM
TKELPKPNNNVKQSVVNSKLPNVAPGPQNCINNALQTDNLETSSSATSLCPSRTDGLVHQ
GFPSSNFNQHQMFKDALPDVEMEGVDPSNSGLFGINNDNLLGFPIETEDLLINALDSVKY
QNHISTDVENNYPMQKDALQEISTSMVSQSFGQSDMAFNSIDSAINDGAFLNKNSWPAAP
PLQRMRTFTKVYKRGAVGRSIDIGRYSGYEELKHALARMFGIEGQLEDRQRIGWKLVYKD
HEDDILLLGDDPWEEFVNCVRCIRILSPQEVQQMSLDGDLGSNVLPNQACSSSDGVNGWR
PRCDQNPRNPSIGPYDQFE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]