dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|348029191|ref|YP_004871877.1| (Glaciecola nitratireducens FR1064)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (Fe-S)-binding protein [Glaciecola nitratireducens FR1064]
Sequence length 64
Sequence
MLSHLEQQNIDVHFHCREGYCGACRTKLISGDVEYLTDPLAFIDDDEILPCCCKPISDIQ
IKLY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]