dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|447916537|ref|YP_007397105.1| (Pseudomonas poae RE*1-1-14)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment cytochrome b561 [Pseudomonas poae RE*1-1-14]
Sequence length 184
Sequence
MNSEMIDRYPTSLRILHWARAVLIAGLLWAGWHMTGLDDEVASKYELYYPWHKSFGVLAF
MLVLVQIVLRWRTPVLPSPPATLAAHERFLSRLVQRAMYVLIVAVPLMGYSMSSTYTMSD
GVFFFGVNLPELLGKNDEWFVVFQRLHKVCAYTLLGLIVVHVLGALKHRFFDKDPRNDVL
RRML

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]