dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

NbS00023815g0002.1 (Nicotiana benthamiana 0.4.4)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment protein AED:0.10 eAED:0.10 QI:141|1|1|1|0|0|4|697|78
Sequence length 78
Sequence
MVQSAKPISSPVPITWYPTLAVFVLAIGLIVTASFFIYEATSPRKYRSLAKELTTGAVAS
VFLGFGSLFLLLASGVYV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]