dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|344210810|ref|YP_004795130.1| (Haloarcula hispanica ATCC 33960)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment phosphoribosylaminoimidazole-succinocarboxamide synthase [Haloarcula hispanica ATCC 33960]
Sequence length 344
Sequence
MTSVKEFRVDEPATAEDLGRGAFVFTDDYSVFDWGKMPDRIPDKGASLCTMGAYNFQLLE
ENHVPTHYEGVRLPDSDEVLDLGEALSADAAPEEMVIELTQVPDLPFEDGRYDYDAYHGA
ADENYLIPLEIVFRNRVGVGSSLRSRTEPADHGLDYDTWPEEVVDLDEPIVEFSTKYEEQ
DRYLDREAADRIAGTASIDRLEELARAVNHIVTQQAAEADLVHEDGKIECLYYDGEIRVA
DVVGTFDENRFSYGGQQVSKEVIRQYHKRTQPEWVEAVSEAKEQADAESVADWKSLCAES
PEPLDEDVIQVARDLYCAGTNAYIGGDVFDAPSLDEAVSAAGEL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]