dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|344211310|ref|YP_004795630.1| (Haloarcula hispanica ATCC 33960)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'-nucleotidase [Haloarcula hispanica ATCC 33960]
Sequence length 452
Sequence
MSPRIIQYSDVEKAYDTPERIGRFAGTVAAADGPDALVVGTGDNTGPGVLSLVTDGEQSL
DLFTALTPAFETLGNHDFDHGLDATRDIIARSPQTWLTANVEQDGERFARRLTRPWASRT
VDGKQLGFVGVTDPDTAAANPQATTLTFTDPLEAVAEAATALRADGADVIVVLSHLGRTD
EELARTCDVDVILGGHVHERRIDRVAGTLLTRPGANGKTVVEVDLGGPEPTAQFRETADG
PVDDRVAEAIEDRLSAAGLDEVVGHVEEPLDRSRATTYGGECRLGNLVADAYRWATGADV
GLQNSGGLRNDTVPLDGALTVGDMVSVVPFEEPLTVAELTGSELRTLCRQGSGRQVEFGE
PDWWHAHLSGVELIWNDDTQTIERLRVDGRPVREAETYTLATSNYLYYTEREFPVLTESH
RVSVADVQYEALADYVRQTDIAPTVDGRLTRR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]