dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|563696955|ref|YP_008869705.1| (candidate division WWE3 bacterium RAAC2_WWE3_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein P147_WWE3C00001G0439 [candidate division WWE3 bacterium RAAC2_WWE3_1]
Sequence length 620
Sequence
MNVLIPFSWLKDYVKTNAGIRDVAKALSEHSFSVEKIIDDDTLEIEVTPNRGDGLSVLGI
ARELAAVLPVKGFSADWVKKSFPVKKYSGRDKLKVKISDNSLVPRFSAVVIDKVKVKESP
ALVKERLSKVGIRAINNIVDVTNYCMIELGQPMHAFDYNKITGHEMTVRESKRGEEIVTL
DGVKRVLPEGVIVIEDGDGRLIDLCGIMGGLNSEVDENTTKVLLFVQVYDPVRIRKSSMS
LGHRTEAALRFEKGVDFESVIPSLQTAVGMLTELSGGEVSSELIDLTGTVYTKKHIKIDY
EKINKIAGTEIKKDFVNSTLTSLGFVIKGSDVYVPSWRYDDIEIIEDLAEEVIRIYGYQE
LPNELPGGTLPHHTKTDNFALEDKTKDFLKHMGFFECYNYSAVPGSMAGHGALKVKNPLN
ADLEFLRTSLTPKLLDVLNKNKGYSETVKLFELSSVYLAKKGDLPEQPYMLGMVARGVDF
LVFKGIVEALFEELGVTGDFPYEITEHSGAIISCELPFDKMVDSAGGSRVYSPLTGFNSI
KEDITIIVGDATSFSEIVSVVSSTDVRVNKVGFKDMYEDALTLSIEFLDRAKQITSEETK
GIRDAIIKNLDSKYGIKLKV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]