dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|385804896|ref|YP_005841296.1| (Haloquadratum walsbyi C23)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment DNA-directed DNA polymerase D large subunit (intein-containing) [Haloquadratum walsbyi C23]
Sequence length 2289
Sequence
MRDADKQYFETLESHLEQAFARARQAKGQGYDPKPEVEIPVARDMADRVENILAIPDVAE
RIRELDDERSREEVALELVTDFVEGTVGDYDTREGKIEGAVRTAVALLTEGVVAAPIEGI
DRVEILSNDDGSEFVNVYYAGPIRSAGGTAQALSVLVADYARSLLDIDEYSARTDETERY
AEEVSLYDRETGLQYSPKDKETKFITKHMPIMLDGEATGNEEVSGYRDLERVDTNAARGG
MCLVLAEGIALKAPKIQRYTRQLAEVEWPWLQDLIDDTIGSDEHSNNSVKNGEADIIKTD
KDTNESETKDGIDSDDYNDSGLEPANSPRADATNKYLRDLIAGRPVFGHPSAAGAFRLRY
GRARNHGFATAGVHPATMHIVDDFIATGTQLKTERPGKAGGVVPVDSIKGPTVRLANGDV
RCINDPEEAEKLQNGVEKILDLGEYLVNFGEFIENNHPLAPAAYVFEWWIQEFEASNADV
QALRDDPTVDLESPTFENAMRWAKKHDIPLHPAYTYLWHDISVTEFDHLADAVATGEITT
NEVSDTNSASGNTSLRVNTNTDDTLTIDTTPAIRETMERLLIEHHQDSDSIHIPAWRALA
LSLGIKIESDNDTGIGDRMWSLTDLSKHARKQDDGKSAIAAVNEVAPFQVRERAPTRIGS
RMGRPEKSEDRDLSPAVHTLFPIGEAGGNQRNLSDAAQSFGDNTERGQISVQLGKRRCPY
CETVGFELQCAECGRHTEPQFVCRECESVLSPDESGRVHCDRCERDVTSAEWQDIDLHQR
YRDALDRVDERESSFEILKGVKGLTSSNKTPEPLEKGILRAKHGVSSFKDGTVRYDMTDL
PVTAVRPKELDVTAAHFRELGYQTDINGNPLQFDDQLVELKVQDIVLPDGAAEHMMKTAD
FVDDLLEQFYELDQFYQIDERDDLIGELVFGMAPHTSAAVVGRIVGFTSAAVGYAHPYFH
AAKRRNCFHPETKIWFRDTDNEWHHETIQTFVEDRLDDPEIDAVGTLVQEVDDNTDREIS
VPSIDDNGNERLQSVTAVSKHRAPNHLVQIETISGREITITPDHEMHIFEQGNLVSKQAS
KITSGEYAVIPKRLQTISPSSHTPQHDLLREFLTRDELTADWLIIHTSDPVRLCNRVFPE
EVTSCKDAVEIMQNTACHLDENKETLIGWLDEGTIPVVLLRRFVETDEALLMSTPDDVQI
GLRGEKVRIDRHIGFTEELTSLLGYYAAAGIVHAQTNPISYESAQQEQSRITFYNIDTQT
QTDLLNALNSVFEIEPIQYNSDGEILGVPGELIRRVFDTVFDVGTQPSHKRIPQALFDAS
ESHITSYLRCFFSTHDSLTTDTRDISATTVSREFKEDIIAALRRLGITAEVTTQQSRSVP
EVLPDWYAIDDTTHHDANNSLNLTRSYVISIASSDAVTLQRDRQAQEQTKYDAQGLIANN
NAIHQSRQVTDGGRKDYITEPITDIEYVDADIDYTYCLTVSETHSLIVNDLSQKQCDGDE
DCVMLLMDGLLNFSREYLPDKRGGSVAADSRLVAVSPDDKIVFTTIEDFWKKLNTPIERN
GKFRKRTCVSEGWQTYAFDENHEASLRPIEKAIRYKADESKQLRRVTTQFGRSLDITDEH
SLFRYDDGIEEVAGDDLTAGDIIVAPRTLDVETIQTTLDLSEYIHDYERCPGEQTRSEEL
NLASKSVISNPRNKESPVVTHNVSSQRSRSTDEMTTLSPTAVGGLESKQNETLRVGESAE
PVERYIDVDDSFGWLLGQFIAQRSISTDALTSAIHTAAKKHAERIVAASDSVFDINPTVN
STERGCEVVFPPVFDTIVSGLTAKEQSEPEQDINHTHTDEIGIPECILHAPDDIVLSFLQ
GFILGENAQRKGNAASEVSEIVSESETTVTLNTTSVGIKDGLVFLCHRLGIIARISEKSG
GEYSAHFEESRYTVSIATEGKTNPLDQILDGERPTMPEGVSVPVPDALLTIHESIANSPH
IDQVIPDTVVQQETVSLETLQSLLTELSTVDLPAQLEAKRDELTLLTGGDLSYLRVESVE
CIDYDGYLYDLQVGGEPVFTANWLYAHNSMDAPLVMSSRIDPSEIDDEAHNMDIVRQYPR
EFYEATRRMEDPDEWEEEVTIAEEYLDTDNEYTGFNHTHDTTDIAAGPDLSAYKTLDSMM
DKMDAQLELARKLRAVDETDVAERVIEYHFLPDLIGNLRAFSRQQTRCLDCGESYRRMPL
TGECRECGGRVNLTVHEGSVNKYMDTAIHIAEEFDCREYTKQRLEVLERSLESIFEDDTN
KQSGIADFM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]