dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ORGLA02G0195900.1 (Oryza glaberrima)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known scaffold:1.0:Oglab02_0255:61701:67849:-1 gene:ORGLA02G0195900 transcript:ORGLA02G0195900.1
Sequence length 1053
Sequence
MDDAVRGQGCVGRLRSFNKTKKKNRNCSDDMRNGDDEEKKKYSHHDMKKNLRNDANEEKR
KSSDDMRDGDFEEKKKCSRHDMKKNLRNDANGERRKSSDDMRDGDDEEKKCSRQDMKKNL
RNDADEEKRKSSDDMRDGDDEEKKKRSRHDMKKNSRNDADEEKRKRKRKRKRKCSDDLKK
SVLNDASKEATSHSDWRKNRKAGSDAEQRGKKLLNGDKKAKSRKVTTPFFEKMRKIKMQR
TSNQNGEKNMKSDGDSYKKTVPLSVNKGKMEKDGTNKRTLSNTLVAKERKMRPSDSMEMK
MKKKKRDASFVQPDERTAQTFSTKNKEKKRKAPSTPLKREQKERVASSDNKKETKKACIV
AIGNEKKNCRDGKKKKRKAAFAFFKFVRDEFEELLFIPPAVAPSLKDLIDRHVYLEDSEG
KCSKIRLSVVDGSLAFYEGWNSFVSEHCIKWGEFLLFEYTPESTFSVRVFGIDSCERLHF
SVKSGGKGAVKKRKERHTLSDDLISHYNGQYQDSEDIHDDPNVSGESPRSKEPKIAVDAE
IGTRNLVAKSINAASETQDSERVESGIGYGSLGALGNKVRNLSNGECDTRSDSVFCIQEK
TRRSEVIIISDEAYSTQVDEDTMKQTAPSEASEIHHVTINTQKDLERVVDGVCCESSVAL
NNKMGNLILGEPKNKNISPACSTEKTNGSEITPTTGAIPLTQENIDTVKLNTLSCFEEDR
STTRESELAAAIPTISETHDSDKDLGQKHQRNSVQVNSIIAVDKYLNDSEMNISGNIFRI
YEAPAGTRCLEKWKRGIVNGRAALDDIGQVRPEKTQKAGEKLVGNCGAMGESPVDLRIES
DVTDTCLKPILNIPIEELSILDSVSISKCGRSRTEVNHLFNQKGATVQLQTKKEPLKPTG
SSGNRKGDKIAVSVNRVFAHQSELQIPQQENGNFTSCVTPVALLPAKAELLDLDDHSLQF
CIPSTIQKWLELPKSLPITCRQKGRYDRNVVILKDPMRRLWPVFYHDKPVFVGFTAGWKP
FAAANNLQAGDVCKFVKEMDEDELAFQVYITRK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]