dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ORGLA05G0222700.1 (Oryza glaberrima)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known scaffold:1.0:Oglab05_0154:168407:173104:1 gene:ORGLA05G0222700 transcript:ORGLA05G0222700.1
Sequence length 712
Sequence
MTGIDLNTVEEDEEEAAEEVAANGSSPAPARAGAVCLELWHACAGPVAPLPRKGGVVVYL
PQGHLEHLGDASAAAAAAAAVPPHVFCRVVDVTLLADAATDEVYAQLSLVPEKEEVARRA
DDGEGEDGDGMKQRFARMPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSQQRPSQ
ELVAKDLHGTEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRGDDGELRLGV
RRAAQLKNGSAFPALYNQCSNLGTLANVAHAVATESVFNIYYNPRLSQSEFIVPYWKFMK
SLSQPFSVGLRFKMRYESEDATERRYTGIITGSGDTDPMWHGSKWKCLLVRWDDDAEFRR
PNRVSPWEIELTSSVSGSHLSTPHSKRLKPCLPHVNPEYMVPRGGGCPDFAESAQFHKVL
QGQELLGFKSHGGTAAATSQPCEARHLQYIDERSCSSDASNSILGVPRLVDRAPLGNPGF
SYHCSGFGESQRLQKVLQGQELFRPYRGTLVDASMGSNGFHQQDSPRAPGVVNKWQAQLH
GRAAFHGPPAPALPSQSSSPPSVLMFQQANSKMPRLEFGHGQLDKHENDRRVRFGPSEGI
ERREQRIPLQPYPTSGEVIDGQVTVEKSHSPGRHGKDGPDNKAVGTNSCKIFGISLTEKV
PAREELDDGDANYSLQSLKQVPKSLGNSCATVHEQRPVVGRVIDISTMDMMI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]