dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSONIP00000021300 (Oreochromis niloticus 76_1.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection scaffold:Orenil1.0:GL831325.1:1047860:1052865:-1 gene:ENSONIG00000016893 transcript:ENSONIT00000021319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 254
Sequence
MLQSSDILGHERPLVIRVSFATCVLATVCLPLLGLITCVFISSVFHFEDATGTHCQVPNY
LPSISASISLSPECHIWRFCIGLHSAPRLLVAFTYFKFYKARFATRFPESSLSCLNLGFS
ISENLGLLLLTYVSSTETYFVHKEGFVLFIVSSLIYMLITCRLWKSIKKYSLNPEDAKSH
HWKVRFLLLNVSFCAFAGFFYWKHNMYCESGSYTFFALFEYLVVFSNMAFHLTAVWDFKS
REVMLISSSEDKDF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]