dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

EMT11662 (Aegilops tauschii 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel supercontig:GCA_000347335.1:Scaffold54420:14517:17145:1 gene:F775_00097 transcript:EMT11662 description:"B3 domain-containing protein "
Sequence length 561
Sequence
MVRQTVHLCSSCTAGSRGDKVEAPGDAGISKMHNPCECCQIKLKFLRQINGNFMHSLVIP
EWFVNQFGGKICGTVRLETSDGNMYDVGVTESMNRTILKSGWSSFVDANQIEENYSLMFR
YLGNARFEVTIFDSNGKENTWCCSGMRNASGVHKPSSFDVDNSSSRGGTTQSSASEGSDS
DGSQKERSYSSEESSAEYNLSIDNPVESDDVRNYYVLSGKCDLTEAQELKLHAFVQKIRP
EIPMLVVLMKKSNVRHHGDLVIRKDYAHKYLPCKDTNIILQLPRKNKIWECKFQIRPSGS
TDAGRRNLSLGDFVGDNLVREGDICLFEPMTNTKQKRFTMTVHILGKLSIDHSPGRTTDI
GSNHGRRCTKMGGVKTKPPINGEEYSSQHEECGVSDNSEECSEPPFMLPHRSCLTTAQEN
KVLEKINDIGSDSELPFYVAIMGKINVCRDSSHYINPPILNFGFRYAARYLRKKFTAGHH
GGKCNAINLVLQREGKSRPWPTKLRYTHIMRASSQQMRVIKGWPSFARDNRLREGGLCLF
KLMENEEQLTMMVYIIRREKC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]