dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

EMT15755 (Aegilops tauschii 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel supercontig:GCA_000347335.1:Scaffold40593:42422:44372:-1 gene:F775_20454 transcript:EMT15755 description:"Vesicle-associated membrane protein-associated protein A "
Sequence length 295
Sequence
MVGGALISVYPDDLTFLFELDKPCYCNLKVVNNSEHHVAFKVKTTSPRKYFVRPNASVVQ
PWDSCTITITLQSQKEYPPDMQSKDKFLIQSTRVAASTDMDEIPPDTFNKEADKVIEEMK
LKVVYTLPSGSSDDSGVTSSANRSFKQGGDDLSMLKNASIEESCKYYFSLRFLNAEANTR
YLFLYKIMKRANMGNRTMFKHHQIIVEISVKLVEREKRYLYFQAGVIIEVGRDAQKPIQT
IQRLKDERDNNLQQNQQMQRELVLYIDLFTLHVVSTHCFSSVQLLVCLSILTFGF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]