dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

EMT21745 (Aegilops tauschii 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel supercontig:GCA_000347335.1:Scaffold24549:19348:21938:-1 gene:F775_43027 transcript:EMT21745 description:"Uncharacterized protein "
Sequence length 154
Sequence
MAMDKGKEFVAPLEKGKEVVSPLVEVLVQDHPSAKQRNYDHYHQESGPSHFCKIILAPKL
ESLPMPLEFMKHFPAIPTEFKLKTNTGCAWRVTVKAPPPTDPVEQPTGVLMKDLPGMPGT
AGGLALRLAQFAFAGVALGVMASTNDFPSVSAFW

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]