dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PH01000017G0270 (Phyllostachys heterocyclavar. pubescens)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PH_genemodel_v1 PH01000017..181270..183742 . - . ID=PH01000017G0270;Name=B3 DNA binding domain containing protein, expressed
Sequence length 173
Sequence
MEFTLINRAATSVAAGGGEHDRSCPSAAEVVEKEHMFDKVVTPSDVGKLNRLVIPKQHAE
KYFPFDASSNEKGLLLSFEDRTGKPWRFRYSYWNSSQSYVMTKGWSRFVKEKRLDAGDTV
SFGRGVGEAARGRLFIDWRRRPDVVASFAPPTHRLPLPSIPFAPSIGLSFQSS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]