dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

MA_10436315g0020 (Picea abies)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment high_confidence
Sequence length 166
Sequence
MTNFSPMGDDDPEVRFMNEHTKREIVDMLRKHTYDEELEHHSKRIKMIAARSAAMNNAEA
SGLGADVCQESEGVVDGNANAASSSTATADRGGLPREHLFDKAVTPSDVGKLNRLVIPKQ
CAEKYFPLDVSSSEKGLLLNFEDNTGKVWRFRYSYWNSSQSYVLTX

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]