dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PITA_000006697-RA (Pinus taeda)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment protein AED:0.07 eAED:0.08 QI:0|0|0|0.66|0|0|3|0|719
Sequence length 719
Sequence
MLSDLYVDPNMLAQRMETELLHNYERTRTLCRTQGQGKRSAALRESEIDSPNVALSLACS
PSQKIVSSAATAIHVLGRQDQFARDESVELRTNEEMKNGCYTEDNQEDEMSSAMTEEFNC
SVMGVSENGTQPKQETVAFKDLCSARSVEKNLHGLERMGSGISVLSVSGGESEGFEDPRR
YSMSTEQAGKLLSSQYKGVVPQPNGRWGAQIYEKHQRVWLGTFNREEDAARAYDRAALKF
RGRDAMTNFSPVGDGDPEVRFMSGHTKREIVDMLRKHTYDEELDHHGKRIKILAAQSAAV
NNAEASGGVAAHVCQENQGQLEGNGNVASSSSADAGRAGLPHEHLFDKAVTPSDVGKLNR
LVIPKQYAEKYFPLDVNSSEKGLLLNFEDNTGKVWRFRYSYWNSSQSYVLTKGWSRFVKD
KKLEAGDIVSFHRGSVQSDHLYISWRRRPPGQPRLGVGSQSLQSKGPGVVYPLKEPPSMN
PFNTVPHAAVVYDAQWMPIFWPSSSHPDAFAQFNSHFVSPVVNKVDSLWSQSAATPLNST
LPFYFSASPTNQTIQSKFYDINSASCQPTELYLNYRNSLNRGDEISTNLKPLHPFLNPAR
ASEESETPEHKPSSTLDPATKKGVRLFGVTLPEAQRLSSQHHGHTASLCQPFSTNIKALH
PFVNPARPSSTEESETPEHKLASSLDPATKKGMRLFGVTLPEAQRLSSQHHGQLNPSLS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]