dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PITA_000033801-RA (Pinus taeda)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment protein AED:0.05 eAED:0.05 QI:0|0|0|0.66|1|1|3|0|658
Sequence length 658
Sequence
MEYEYEVVDVTVCETSEGPPNGLRGKRSASTTTLWQSEIDSANEALSLACCVTNVEMSFT
VYSEKDASASTPANHDLGRQDWCARDKAQEQTTNEGMKGWGSAEDRQDDDVESAMTEELN
PSAMGISENGWQPKQDAVMLKASGSPRSMEKNFRGQQRMGSEMSVVSGSGGESDVFEDPR
RYSMSMEQTGKLPSSHYKGVVPQPNGRWGVVPQPNGRWGSQIYEKHQRVWLGTFDEEEDA
AKAYDRAALKFRGRDAITNFSPARDGDSEARFMREHSMGEIVDMLRKHTYDAEFEHHRKS
LMLREALSASENKAGASGLKVSGVCQENQETVYANTNVSSSAAVAAKDMEDPPREHLFDK
ALTPSDVGKLNRLVIPKQYAEKYFPLDANSSEKGLLLNFEDDTGKVWQFRYSYWNSSQSY
VLTKGWSRFVKDKRLETGDIVSFHKGFAQTDHFYISWSRRPSGQPGLGFDPHYQKSKAEV
VYPVKRPSFLNLFNSRGIDNAARWMPVFWPSSSNPNSITQFSSHSFSSPIRKIGHIDALG
SQCSATPFNSAIPFYFSASPTNQTVQSRFHAINSDASQPMDLKKSLNSGDGRPNIAPLHP
FVEPSEPSTAQGLVTPEYKVVSGLDPATKKGVRLFGVTLAEPQRFSVQHHEQLNLFPR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]