dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

PITA_000038031-RA (Pinus taeda)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment protein AED:0.05 eAED:0.06 QI:0|0|0|0.5|1|1|2|0|651
Sequence length 651
Sequence
MNEYKIRKLRSAEQGTGVAPTTPNLSERVDRNRGVTSNASGGPAWINPVLQVGSVCYDGL
HGGAKKSVAPTTLTKSEMDCPSVVRSLGYCPMDDEISSINCSKKNTSPSTPASDEVEEPT
MKEAMEGDSSTEYNQDNEVSSAVTEEFTPSIKCFSENGRQLELEEGQFKDWVLARSKGKN
VQGLQSLGGGINVVPEPAGESHGFEVMRRYSLMSLQQTGKLQSSQYKGVLTQPNGRWGAQ
IYEKHERVWLGTFNKEEDAAIAYDRGALKFRGRDAMTNFSSARGGNPEARFMREHTKEQI
VDMLRKHSYDKEFEHHSKRIMMTAARPVSTTNNEELGSKGSCKRETETKSTDDGNGNSAM
AGLLRQHLFDKVVTPSDVGKLNRLVIPKLHAQKYFPLVIDSSETESLLNFEDTTGKIWRF
RYSYWKSSQSYVLTKGWSRFVKDKKLNVGDFVSFHRGSPEPRQLYISWRHRASVRPQLGL
GPQSGQSKAEFVHQGSLSSNSFNSGTQVTVGNVQWLPNTWPGFSNYAAYTQFNSNYILPL
VNKVGNFDRLCSHIPETSLKGDFSFRFSESHTRQTDQDRFRDINTDELPTIGLYLNLHNS
LNSGDGSTNIKPLHQPSAAQEGEAPEHKATSSLDPASKKGVRLFGVSLTES

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]