dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

OMERI02G34810.1 (Oryza meridionalis 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel chromosome:ALNW00000000:2:36540356:36545305:-1 gene:OMERI02G34810 transcript:OMERI02G34810.1 description:""
Sequence length 724
Sequence
MTGIDLNTVEEDEEEAAEANGSSPAPARAGAVCLELWHACAGPVAPLPRKGGVVVYLPQG
HLEHLGDAPAAAAAAVPPHVFCRVVDVTLLADAATDEVYAQLSLVPEKEEVARRADDGEG
EDGDAMKQRFARMPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSQQRPSQELVAK
DLHGTEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRGDDGELRLGVRRAAQ
LKNGSAFPALYNQCSNLGTLANVAHAVATESVFNIYYNPRLSQSEFIVPYWKFMKSLSQP
FSVGLRFKMRYESEDATERRYTGIITGSGDTDPMWHGSKWKCLLVRWDDDAEFRRPNRVS
PWEIELTSSVSGSHLSTPHSKRLKPCLPHVNPEYMVPRGGGCPDFAESAQFHKVLQGQES
LGFKSHGGTAAATSQPCEARHLQYIDERSCSSDASNSILGVPRLGDRAPLGNPGFSYHCS
GFGESQRLQKVLQGQELFRPYRGTLVDASMGSNGFHQQDSPRAPGVVNKWQAQLHGRAAF
HGLPAPALPSQSSSPPSVLMFQQANSKMPRLEFGHGQLDKHENDRCVRFGPSEGIERREQ
RIPLQPYPTSGEVIDGQVTVEKSHSPGRHGKDGPDNKAVGTNSCKIFGISLTEKVPAREE
LDDGDANYSLQSLKQVPKSLGNSCATVHEQRPVVGRMVAEYQGDGGTDDSDIFILDVGVG
ALIM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]