dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|385809231|ref|YP_005845627.1| (Ignavibacterium album JCM 16511)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment aminomethyltransferase [Ignavibacterium album JCM 16511]
Sequence length 359
Sequence
MKRTKLYNIHKNLNAKIVEFAGFEMPIQYSSIIQEHKAVRHNVGVFDVSHMGEIFIRGKQ
ALDFVQYITVNDASKLFPGRVQYSAMCYEDGGIVDDLLVYKISDEEFLLVINASNILKDF
EWMNKNNKFSVEIINRSDDFSLLAVQGPDSLKTIQKIADKEIDLEYYHFTKMKIANVEMI
VSRTGYTGELGYELYFEGDEATAEKVWNAVFEAGKEFNIQPVGLGARDTLRLEMGYCLYG
NDIDQTTNPLEAGLGWITKLNKSDFVGKDALLKAKENITRKLVAMISEEKTFPRHGYDIS
ANRKKIGHITSGTVSPILDKPIALGFVEKDFSAVGTEVNFVVRGKEFPAKIVKLPFIKK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]