dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|397657097|ref|YP_006497799.1| (Klebsiella oxytoca E718)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Klebsiella oxytoca E718]
Sequence length 352
Sequence
MGLSHAYADSSGLAFDRIFMVTETDGTFITARQFPQMVKFIPAPLHDGLHLTAPDGSSAM
VRFSDFSIQQEPTEVWGNHFTALIAPDRVNQWLSGFFNRSVQLRWLGPALSRRVKRHDAV
PLSFADGFPYLLANEASLRDLQNRCPASVSIEQFRPNLLVTGAAAWEEDTWKVVRIGEVI
FDVVKPCSRCVLTTVSPERGQKHPSGEPLSTLQRFRTALDNGDVDFGQNLIARNSGVIRV
GDALEVLARGPAKAYGAGESDTTPAPEAQENATVEIAWQGVSFTGNNQQILLEQLEQQGI
RIPYSCRAGICGSCRIRLEEGEVSALKKNAVAADGTILCCSCVPKTAVRLAP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]