dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|DalEC12_1|18085|gm1.693_g (Daldinia eschscholzii EC12 v1.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 652
Sequence
MPHTEKTGERRPSQSRGNRLSQLFSSSPKANQQPSAQQALMAMQNGSSPSITASGLALPT
ISLSTATAGEPNQDEPPTTLFQPPSSTEISRQKRFDAQFGPLVDPTDRYVSKHHGEPLEA
PIIDEPPYYYVLTTYISYLLLLALGHIRDFFGKRFSKKQTYKTLRVANGYAPLNDDFDSF
YTRRLKMRIDDCFARTSTGVPGRYINVLNRVSDDFNETYRYTGGATETLNMSSYNYLGFA
QSEGPCANAVEECVKRYGLSFCSPRADSGTSDLVCEVEKEIASFVGKPAAMVFSMGFVTN
ASSFPALVSKGCLIISDELNHASIRLGARLSGAVIRSFKHNDMLDLEKKLREAIAQGQPR
THRPWKKILVAVEGLYSMEGTMCDLPGILNLKDIYKFALYVDEAHSIGALGPKGRGVCDY
FGIDPSRVDILMGTLTKSFGANGGYIAAEKHIIEKLKSTNSATMLGESPTPAVLMQILAS
LKIISGELVPGQGEERLQRIAFNSRYLRLGLKRLGLIVYGHDDSPIIPVTLYNPAKISAF
SHEMLKRRISVVVVGYPATPLISSRARFCVSAAHNKDDMDRLLAACDEVGDILQLKFSTG
IAGGLKPLPEDVLEKEKIGQGAKGPKLVIEPPRWSLEEVIARGSEDAKMRLR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]