dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|386354415|ref|YP_006052661.1| (Streptomyces cattleya NRRL 8057 = DSM 46488)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ArsR family transcriptional regulator [Streptomyces cattleya NRRL 8057 = DSM 46488]
Sequence length 103
Sequence
MPTDVFGALANPVRRHLLDALRDGPRAVNDLVSEFELSRPAISEHLQVLRQAGLVREEPR
GRQRFYHLEPRRLEEVGDWLHPFERYWRGRLRSLAELLDEENP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]