dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|Serla_S7_9|448229|estExt_fgenesh2_pm.C_60126 (Serpula lacrymans var. lacrymans S7.9 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 386
Sequence
MAPMTSIRLSGDKIEIVNQLLLPHTTEFIEIQTIEQAHDAIKSMKIRGAPAIASLAALSF
GAYLSRGLEASPAPEYLASPEALRDHVLPILDFLITARPTAVNLGAATRRLTKTLQSSID
AGKDPRSIVLVLIAESHLVADEDVGRNKEMSKWGGEWLIDQVKQAGGDGTSLNVLTVCNT
GSLATSGYGTALGLITYLHEVGNLGKAYYTQTAPYHQGSRLTALELKTLQIPSVMICDTM
VGSLFQHHKIHAVAVGADRVAKNGDTANKIGTYNAAVLAARHKIPFIVVAPISTVDLDVA
DGSGIPIEHRPPLEACIVRGALHPPTLNAQGQKEQAQVMITPTDLYEIYNPSFDVTPAEL
ITAIVTEKGVAVKKEGSQIFDLSAIV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]