dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|Spoth1|50180|e_gw1.4.3313.1 (Sporotrichum thermophile ATCC 42464 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 383
Sequence
MDFASLMSQEISKAKGGSGSGSGSGSSTGGGEQKKYISRREAEEARRAAYLAEQKRLEEE
RAAKAAAKRRREEEAAQEARAREEKRRRLAEEARLRREAKEAEEERARRRRLGLPEVPLV
KQGEEEGGEGDKKKAEEGGDEDDLDGDGEDAGDIAEEELVKKLRELGEPAILFGENHAAR
LMRYRKVSRGGALAAAAGPIATTLVPVEEKDMKVPDKVPPASDKKARRFLYRQLASYFNM
VLREWEAALARENNADTFAGQAARNAMTSSKDSMRPLFRKFEQGNLDESILEAIVEIVKA
AQERRYVDANDGYLRLSIGKAAWPIGVTMVGIHERSAREKLHGGERGHIMGSEVTRKYLQ
SIKRCLTFAQVRWPPEDIRQLMG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]