dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Si031959m|PACid:19709398 (Setaria italica v164)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 435
Sequence
RRRRRRGDRPKTRTASRKEASGLAATVHDVPDHLLELIFLRLDSCATVVRAGSACKRWCR
VLAGAGFLSRFGSLRAPVLAGHYHTVNPFFDSSPPPAGGMPGFVPSATTAATVNPRGFSL
DFLPDSKTWEIADSRGSLLLCKKTTPLASWTGYYYLPDQFIVCEPVTRRHQGILSPPYLQ
GECIGLFLLDGGDDNIRCSGGRRIGMSNFKILFVLHEFHRWVYGRGVPLACAFSSGSDGG
WRVLQSAASENVTVPHNIEQISFAGRAGGSAYWAIGEDGAMLVLDEATEGFSVVMFPEDL
LRSYDRYNFQVTGGEDGALRIVRLLNNELKVFARRHGSDDWVLENLVQLPEATRGLPGRQ
DRFFRQHEALIVAAESTHVLVTPQEKTWPFSVDLETMEVERARERNKYAGTAFPYELPWP
PVLMACAERGRRSRR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]