dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

symbB.v1.2.036059.t1|scaffold5003.1|size31904|2 (Symbiodinium minutum clade B1 v1.2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 605
Sequence
MVKGAVGSVRMDVRVGRAEELLPQLRKELGVKSVDLLILGSLQGHRIPQFPMKRKFEEAS
SSSAVEGHLVSCSPFQPQYEPEEKIRTVVVENFPMLGKAAAWRFLEWVQENPQGVCSLPT
GKTPEYFIKWVQRILQDWHLPEIQVEVKKFGLTSKKPELHELTFVQIDEFYPISPQQHNS
FHYYVNEYYIKGFGLDPSKALLMDCSKIGLDLHTPSFGPTGEPQDHHQMSMDDVWPDGKV
DLTLRTREPQSRLERLQQRVLRQVDQWCADYEEKIRQLGGIGFFMGGIGPDGHVAFNCQG
CDHFATTRLDQLNYASQAAAAGDLGGIEAVRKRKVITIGLGTITFNPDCVALICAAGEAK
AQVVQHAVEERPHVNYPATALHKLPRAAFFLTSGAAKLLSRRQLALLEQLKTVDQPLVER
ALVSLCCKLRKKLLDLNQKDLESCAFAKEVLKRSGRGLETCAMEVREILIKKIEKGCQVR
ENAKFLHTEPHHDDIMLGYLPSVLRHTRVPSNQHHFVCGTSGFNSVSNKHMLMLLQRVER
FLTSPTFQRLCKEDYFSSVGPNAIDFRRRDVWKFLDGIAAADTELRDEGAARRLVYNLKS
KRYVL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]