dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

YJL084C (Saccharomyces cerevisiae PW5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ALY2 ORF Verified Protein proposed to regulate the endocytosis of plasma membrane proteins; interacts with the cyclin Pcl7p and ubiquitin ligase Rsp5p; phosphorylated by the cyclin-CDK complex, Pcl7p-Pho85p; mRNA is cell cycle regulated, peaking in M phase
Sequence length 771
Sequence
MPMDQSISSPLFPMEKDIDIPLNATPLAQSSSLQLFIHLAEPVVFLQGFDPQKTEYPSVV
LRGCLVVRILKPTKLKSISLSFKGYSRTEWPEGIPPKRQEFVEIKDIVDHTWALYPPTEQ
KSKKKMGASAPNESNNAANNFLTKESGASLYRTLSDNETITSRKNSISGLSSLNLSPLGT
PGNSSVNVKDRESRQRSRSSSVTSSNGPSRNLSPINLLKRATSPSVSHHNYKPTTTSIFS
DLLNNTFTHNDAASHHGHHIPTSSNHLAMTSNNFTSGSGGEFFVFQPGDYIYAFEELIPQ
AYPESIKADFGFVEYFLFASIERPGAFKSNISARQVVNIVRTQANNSVEESEPIIISRDW
ENQLYYDIVIASKDIILDAFLPITFKFAPLDKVTLHRIRIYVTETMEYYCREKKVHRMEP
TKKFLLTEQKGPKLPNLPNDANLSKAKNMGNLLQDPKNGDLVNKEYEYQIFIPSRFNNHQ
QLHPDTSYENIKANHWIKICLRLSRVVDNKRKHYEISIDSPIHVLHRLCSHANTLLPSYD
GHPASFPKETDSSISSILESSDDNINLYHNSNIFFPKEVLSSPVLSPNVQPLDILIPHLP
STSLTRNSRQFNRNSKSHPSDNTIFNSAKLKSNIYQPESLQRELASPQAIPLSPITSPMS
NMEVPPPDFDFSSDFISDAASGTTTTEVSSSESSILPRDPPSYKDTVLHDNNQKRRPNSK
HPTPPSLKASHPNKNSDKNSSETLNKKESMSKIEENKHKRETTPKKREIGT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]