dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

YJR088C (Saccharomyces cerevisiae T73)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment EMC2 ORF Verified Member of a transmembrane complex required for efficient folding of proteins in the ER; null mutant displays induction of the unfolded protein response
Sequence length 292
Sequence
MLKDLVREKLLTIMNTKAYTQFNPEQLLQLENEMKIYMKSGDSGLTEGNYFFLMEMLFYV
LVYRNQDVDAQVVYNTLRDRLGENSYKMVIMKATLLQINGNDKGAIEYLENLLNDDLEYE
TDFVTYVSIAKKLIAIKTTSKNLSQESVLKEVVALTDKFPLDAELWWYASEIYFEMGQFE
KARYCLEQVLCITPFNYACFGRLSETLYYEALRSKKQTKTELLEKALKNALRSVELSELY
LKGWALVNIISRELGRNKQNDLIKLSASKLNEISAKSNNKDKITAELILNKI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]