dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

YMR115W (Saccharomyces cerevisiae T73)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment MGR3 ORF Verified Subunit of the mitochondrial (mt) i-AAA protease supercomplex, which degrades misfolded mitochondrial proteins; forms a subcomplex with Mgr1p that binds to substrates to facilitate proteolysis; required for growth of cells lacking mtDNA
Sequence length 501
Sequence
MLLQGMRLSQRLHKRHLFASKILTCTTNPAHIRHLHDIRPPASNFNTQESAPIPESPANS
PTRPQMAPKPNLKKKNRSLMYSIIGVSIVGLYFWFKSNSRKQKLPLSAQKVWKEAIWQES
DKMDFNYKEALRQYIEALDECDRSHVDLLSDDYTRIELKIAEMYEKLNMLEEAQNLYQEL
LSRFFEALNVPGKVDESERGEVLRKDLRILIKSLEINKDIESGKRKLLQHLLLAQEEILS
KSPELKEFFENRKKKLSMVKDINRDPNDDFKTFVSEENIKFDEQGYMILDLEKNSSAWEP
FKEEFFTARDLYTAYCLSSKDIAAALSCKITSVEWMVMADMPPGQILLSQANLGSLFYLQ
AEKLEADLNQLEQKKSKESNQELDMGTYIKAVRFVRKNRDLCLERAQKCYDSVIAFAKRN
RKIRFHVKDQLDPSIAQSIALSTYGMGVLSLHEGVLAKAEKLFKDSITMAKETEFNELLA
EAEKELEKTTVLKAAKKEGLN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]