dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

YOL145C (Saccharomyces cerevisiae T73)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment CTR9 ORF Verified Component of the Paf1p complex that binds to and modulates the activity of RNA polymerases I and II; required for expression of a subset of genes, including cyclin genes; contains TPR repeats
Sequence length 1034
Sequence
MTNAMKVEGYPSMEWPTSLDIPLKASEELVGIDLETDLPDDPTDLKTLLVEENSEKEHWL
TIALAYCNHGKTNEGIKLIEMALDVFQNSERASLHTFLTWAHLNLAKGQSLSVETKEHEL
TQAELNLKDAIGFDPTWIGNMLATVELYYQRGHYDKALETSDLFVKSIHAEDHRSGRQSK
PNCLFLLLRAKLLYQKKNYMASLKIFQELLVINPVLQPDPRIGIGLCFWQLKDSKMAIKS
WQRALQLNPKNTSASILVLLGEFRESFTNSTNDKTFKEAFTKALSDLNNIFSENQHNPVL
LTLLQTYYYFKGDYQTVLDIYHHRILKMSPMIAKIVLSESSFWCGRAHYALGDYRKSFIM
FQESLKKNEDNLLAKLGLGQTQIKNNLLEESIITFENLYKTNESLQELNYILGMLYAGKA
FDAKTAKNTSAKEQSNLNEKALKYLERYLKLTLATKNQLVISRAYLVISQLYELQNQYKT
SLDYLSKALEEMEFIKKEIPLEVLNNLACYHFINGDFIKADDLFKQAKAKVSDKDESVNI
TLEYNIARTNEKNDCEKSESIYSQVTSLHPAYIAARIRNLYLKFAQSKIEDSDMSTEMNK
LLDLNKSDLEIRSFYAWYLKNSKERKNNEKSTTHNKETLVKYNSHDAYALISLANLYVTI
ARDGKKSRNPKEQEKSKHSYLKAIQLYQKILQVDPFNIFAAQGLAIIFAESKRLGPALEI
LRKVRDSLDNEDVQLNLAHCYLEMREYGKAIENYELVLKKFDNEKTRPHILNLLGRAWYA
RAIKERSVNFYQKALENAKTALDLFVKESSKSKFIHSVKFNIALLHFQIAETLRRSNPKF
RTVQQIKDSLEGLKEGLELFRELNDLKEFNMIPKEELEQRIQLGETTMKSALERSLNEQE
EFEKEQSAKIDEARKILEENELKEQERMKQEEEARRLKLEKQAEEYRKLQDEAQKLIQER
EAMAISEHNVKDDSDLSDKDNEYDEEKPRQKRKRSTKTKNSGESKRRKAAKKTLSDSDED
DDDVVKKPSHNKGK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]