dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

YOR051C (Saccharomyces cerevisiae T73)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ETT1 ORF Verified Nuclear protein that inhibits replication of Brome mosaic virus in S. cerevisiae, which is a model system for studying replication of positive-strand RNA viruses in their natural hosts; deletion increases stop codon readthrough
Sequence length 412
Sequence
MAKRPLGLGKQSREKKRKVESVEKKSDEPSRESTPVRSQMSVELDDDADLDDELAQLKGL
WSKYFHSDRDDEYVLNGIVHECDRLLRLSEEDKEIKKTLNDIFHGIYALALSELTIFKAG
DEEATEEKRKKDVSSFFENAIERVELGLSHFPESQFLKLVLAKIIFQRIPLEYISNLHLK
SKDKKLDLVGQLEHGKKHFSIYENDTEFTFEILQMVNDLLDIVENFGREQSIQEGIDSDN
EEEEELIDIELEPEHPVYPLQQSLEANYEWLRNHFDKLLDNTNTDMKIYASIANTLGELY
LKKAEEPSKVFLSLQYDDGGSKKVSDKEAKNVQETALKHTKKALEYLEKAKLEDDPDTWV
QVAEAYIDLGNLLDNESAEQEEAYKTAEEILGKANKASHGKFQDVLDNFLQG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]