dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|523521091|ref|YP_008207171.1| (Lactobacillus rhamnosus LOCK908)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Transcriptional regulator [Lactobacillus rhamnosus LOCK908]
Sequence length 140
Sequence
MTMKKQYLSASQSVNQFNRLFSPVSTADIPLNQQNLLFWMATDSTPRTPTNLAKEMHVTK
AAITKASGPLLERGLLDKQPDPEDCRSFKLVLSEAGEKAVEDLGPEYLGNLERLYNELGE
KKYLKLIKLLSQATGVTVKE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]