dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|427722567|ref|YP_007069844.1| (Leptolyngbya sp. PCC 7376)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment rubredoxin-type Fe(Cys)4 protein [Leptolyngbya sp. PCC 7376]
Sequence length 233
Sequence
MDMQNARTVDNLEAAFGGESQANRKYLFFADVAKKLGMSDLAKLFRETANQETEHAFAHF
RLLHPELVVKNPDALSDADKKKIAARCLELAIAGETYEYQTMYPEFAAQAQQDKDAGAEA
EFKEQEEESKEHAEMFHTAAKNFGLLTSIEEHHANQYSDALKALDGGEATPRSLGQKWIC
KKCSMIYDPAVGDPDSGIAAGTNFEDIPDDWQCPICGATKKTFVPYEEYVAAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]