dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Tc04_g023340 (Theobroma cacao B97-61/B2 v1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Putative Vacuolar protein 8
Sequence length 704
Sequence
MELQRSQDQGLPERKGQKRKLEEENQEDRETSLPTGDARRALLAEVTAQVSVLDSTFSWR
EPDRAAAKRATHVLAELAKNEEVVNVIVEGGAVPALVKHLQAPPCSDGDRSPKPFEHEVE
KGSAFALGLLAVKPEHQQLIVDSGALSHLVNLLRRHKDGSTSRAVISVIRRAADAITNLA
HENSSIKTRVRMEGGIPPLVELLDFTDTKVQRAAAGALRTLAFKNDENKNQIVECNALPS
LILMLRSEDAAIHYEAVGVIGNLVHSSPNIKKEVLAAGALQPVIGLLTSCCSESQREAAL
LLGQFAATDSDCKVHIVQRGAVRPLIDMLHSPDVQLKEMSAFALGRLAQDTHNQAGIAHN
GGLVPLLKLLDSKNGSLQHNAAFALYGLADNEDNVSDFIMVGGVQRLQDGEFIVQATKDC
VAKTLKRLEEKIHGRVLNHLLYLMRVAEKPVQRRVALALAHLCSPEDQRTIFIDNNGLEL
LLGLLGSTSPKQQLDGAVALYKLANKAMSLSPMDAAPPSPTPQVYLGEQYVNNATLSDVT
FLVEGRRFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIRWEVFELMMRFIYTGSV
DVTLDIAQDLLRAADQYLLEGLKRLCEYTIAQDISLENVSSMYELSEAFHAISLRHTCIL
FILENFDKLSTRPGHLHLIQRIIPEIRNYFAKALTKPNPHNLRL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]