dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|414078463|ref|YP_006997781.1| (Anabaena sp. 90)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein ANA_C13292 [Anabaena sp. 90]
Sequence length 1150
Sequence
MKRQIAIISCLLLLPYPVSAIETQIKTTKLLTQSSQRCKLRPANPENGIYSEPQLQTIAK
QITVRVRDKERGASGTIFARKDNSYLVVTNSHVVRRINNINIITADGQKYAGKILPNTNF
DKFDLAIVEFTSNQKYCLPSEIADRIASFDINLETPVMAAGYAVSEDKLVLTTGKIQQII
SQPSLKYGYEIGYTSDIQQGMSGGAIISNTGNFIGINGISSYPLSNSAYTYTNGKRPTNT
EIQEFRKLSWGIPIKTVLGQVKLEVLTAYNLPIPDIKQQIAEVPLTGWLGELEAKAKQIT
VRIDSSSGANGSGIIIAKEGDIYTVLTAAHVVCKPPDKVGPCEPNTYKILTVDGKQYPVE
PSTIKLEEGVDLAVVKFTSRENYQVATLANYPIKDDEYMFTAGYPRLGEKSPWRFTLGQI
YSKETGLLATTQSDFNNNSSGTAQSAISLTGGYELVYSSITFGGMSGGPVLDSQGRVIGI
HGRTEGQAAIDNNSNSKETIQLGNSLGIPVSTFLALATRLNTQAQKIETTPPPELNQQKV
KSIQTAILSVDVSQGNTTASQWLERGNQLWRLRRYPEAIQAFDAAINQKPKFIHLAYYGK
GLALGSSGKYPEAITALQQAVKSQPDFVPAWDYLSSVYRESNQLDKALAAINQAIQLQPN
NPNLYNQKRGVLSDLKKYKEAAAAINKAIELSPRAAFYYNQGIVRYELGDKPGAIDDYTQ
AIKINPNYAKAYNNRGIVRNELGDKPGAIDDYNQAIRINPNYALAYYNRGNVRYELGDKQ
GAIDDYTLAIKINPNYANAYYNRGIVRYELGDKPGAIDDYNLAIKFNPNYAQAYYNRGIV
RDDLGDKPGAIDDYNQAIKFNPNDAQAYYNRGIVRYELGDKPGAIDDYTQAIKFNPNDAN
AYYGRGSVRNDLGDKQGAIDDYTQAIKFNPNDANAYYGRGSVRNDLGDKQGAIDDYTQAI
KFNPNDANAYYNRGFVRNELGDKQGAIDDYTLAIKYNPNYAAYYNRGIVRNELGDKQGAI
DDYTLAIKYNPNYAAYYNRGIVRNELGDKQGAIDDYTLAIKINPNYADAYYNRGFVRNEL
GDKQGAIDDYTLAIKYNPNYAQAYVRRGSVRYQLGDKPGAKEDLQRAAQLFKDQGNTAAY
EQTMAFLKEL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]